General Information

  • ID:  hor002031
  • Uniprot ID:  Q95335
  • Protein name:  Progonadoliberin-1
  • Gene name:  GNRH1
  • Organism:  Tupaia belangeri (Common tree shrew) (Tupaia glis belangeri)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Tupaia (genus), Tupaiidae (family), Scandentia (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLRPGGKRNAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
  • Length:  69
  • Propeptide:  MELVPKFLAGLILLTLCVGGCYAQHWSYGLRPGGKRNAENLIDSFQEIAKEADQLAEPQHFECTISQPRSPLRALKGALESLIEEETGQKKI
  • Signal peptide:  MELVPKFLAGLILLTLCVGGCYA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95335-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002031_AF2.pdbhor002031_ESM.pdb

Physical Information

Mass: 900282 Formula: C341H543N99O108S
Absent amino acids: MV Common amino acids: E
pI: 5.69 Basic residues: 11
Polar residues: 16 Hydrophobic residues: 21
Hydrophobicity: -84.64 Boman Index: -16011
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 76.52
Instability Index: 7565.07 Extinction Coefficient cystines: 6990
Absorbance 280nm: 102.79

Literature

  • PubMed ID:  NA
  • Title:  NA